IDUN Peptides TB-500 Research Guide 2026: Specifications, COA & LOOT30 for Up to 30% Off
Looking for an IDUN Peptides TB-500 promo code? LOOT30 is a verified working code that gives up to 30% off. If full-length Thymosin Beta-4 is already on your legitimate laboratory research purchasing list, you can use the IDUN Peptides LOOT30 offer and enter LOOT30 at checkout. The exact saving is displayed in the final order total.
Quick Answer: What Is IDUN Peptides TB-500?Research-use notice: IDUN Peptides states that its products are intended for in-vitro research and laboratory use only, not for human or veterinary use. This article discusses TB-500 as a research material and does not provide human-use dosing, administration, reconstitution, or treatment instructions.
IDUN Peptides currently lists its TB-500 product as full-length Thymosin Beta-4 (Tβ4), a 43-amino-acid peptide corresponding to UniProt P62328. The current product page reports ≥99% HPLC purity, third-party HPLC + LC-MS testing, a Certificate of Analysis per lot, and a starting price of $44.99.
The most important detail is the identity distinction: the research-peptide market sometimes uses "TB-500" to describe both full-length Thymosin Beta-4 and a much shorter fragment. IDUN explicitly says its product is the full-length 43-residue form, not the 7-residue fragment.
| Question | Current answer |
|---|---|
| IDUN Peptides promo code | LOOT30 |
| Verified discount | Up to 30% off |
| Current listed TB-500 price | From $44.99 |
| Listed size | 10 mg |
| Product identity | Full-length Thymosin Beta-4 / TB4 |
| Amino-acid count | 43 |
| UniProt | P62328 |
| Reported HPLC purity | ≥99% |
| Identity testing | LC-MS |
| COA | Per lot |
| Product form | Lyophilized |
| Stated use | In-vitro research only |
You can check the current listing and apply LOOT30 through the official IDUN Peptides offer.
What Is TB-500?The name TB-500 requires a little care because it is used inconsistently across the research-peptide market.
IDUN's current product is identified as full-length Thymosin Beta-4, a 43-amino-acid peptide with an average molecular weight of approximately 4,963 Da. Its listed mature-chain sequence is:
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
The product corresponds to UniProt P62328 and has a monoisotopic mass listed as approximately 4,960.4863 Da.
This distinction is important when comparing research materials because a product labeled "TB-500" is not necessarily chemically identical across every supplier.
For researchers who specifically require full-length Thymosin Beta-4, checking the sequence and analytical identity is much more informative than relying on the product name alone.
If that is the material you need, the IDUN Peptides LOOT30 offer provides the current product route, and LOOT30 can reduce an eligible order by up to 30%.
IDUN Peptides TB-500 SpecificationsThe current IDUN product page provides an unusually detailed specification profile for its TB-500 listing.
| Specification | IDUN-listed TB-500 |
|---|---|
| Compound | TB-500 / Thymosin Beta-4 / TB4 |
| Form | Full-length 43-amino-acid peptide |
| Mature-chain sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Amino acids | 43 |
| Average molecular weight | 4,963 Da |
| Monoisotopic mass | 4,960.4863 Da |
| Molecular formula | C₂₁₂H₃₅₀N₅₆O₇₈S |
| CAS listed | 77591-33-4 |
| UniProt | P62328 |
| PubChem CID | 45382195 |
| HPLC purity | ≥99% |
| Identity confirmation | LC-MS |
| Appearance | White to off-white lyophilized powder |
| Listed size | 10 mg |
Multiple identifiers are valuable for research procurement because they provide ways to cross-check the material in databases and analytical records.
The 43-amino-acid sequence is particularly important. If you're comparing two products marketed as TB-500, don't assume they represent the same molecular entity until the actual sequence and analytical documentation have been checked.
You can review the current product through the IDUN Peptides offer and enter LOOT30 at checkout to see the available discount.
Full-Length Thymosin Beta-4 vs the TB-500 FragmentThis is arguably the most important section for anyone searching for TB-500 specifications.
IDUN explicitly states that its product is the full-length 43-amino-acid Thymosin Beta-4. The company notes that "TB-500" is also used in the research market for a shorter seven-residue fragment, Ac-LKKTETQ, which is chemically distinct from full-length Tβ4.
That means the following are not interchangeable descriptions:
- Full-length Thymosin Beta-4
- 43-residue mature Tβ4
- The shorter TB-500-associated fragment
- A generic product labeled only "TB-500"
For procurement, the safest approach is to verify:
- Exact sequence
- Molecular weight
- Chemical identifiers
- Analytical identity
- Lot-specific COA
This distinction also makes the current IDUN listing more specific than a generic TB-500 product description because IDUN explicitly identifies the 43-residue full-length form.
If full-length Tβ4 is the material your research requires, you can check the current IDUN Peptides LOOT30 offer.
What Does IDUN Report About TB-500 Purity?IDUN reports ≥99% HPLC purity for its TB-500 product and says the material is third-party tested using HPLC and LC-MS. The company also states that a COA is supplied per lot and that identity is confirmed lot-by-lot by LC-MS.
That provides two different categories of analytical information.
HPLC addresses chromatographic purity under the stated analytical method.
LC-MS provides mass-based information that can support molecular identity.
For researchers comparing TB-500 suppliers, it is therefore better to inspect both types of documentation rather than choosing a supplier simply because its product page displays a high purity percentage.
A 99% figure can be useful, but the context behind the number matters.
You can review IDUN's current documentation through the official offer and apply LOOT30 for up to 30% off an eligible order.
HPLC vs LC-MS for TB-500When evaluating TB-500 analytical testing, HPLC and LC-MS should be considered complementary techniques.
HPLC purity testingHigh-performance liquid chromatography separates compounds within a sample.
For a peptide research material, the resulting chromatogram can provide information about the principal component and other chromatographically distinguishable components.
A reported purity value therefore needs to be understood in the context of the method used.
LC-MS identity testingLiquid chromatography-mass spectrometry combines chromatographic separation with mass analysis.
For a large peptide such as full-length Thymosin Beta-4, mass confirmation is particularly useful because the expected molecular mass provides an additional identity check.
IDUN states that its TB-500 identity is confirmed lot-by-lot through LC-MS, with the result documented on the corresponding COA.
That combination of methods gives a researcher more information than a generic "≥99% pure" statement by itself.
If analytical documentation is important to your procurement process, check the IDUN Peptides TB-500 offer and use LOOT30 to check the discounted total.
How to Evaluate an IDUN TB-500 COAA Certificate of Analysis is most useful when it is connected to the exact batch being purchased.
For an IDUN Peptides TB-500 COA, check:
| COA item | What to verify |
|---|---|
| Product name | Does it identify the intended material? |
| Sequence / identity | Is it consistent with full-length Tβ4? |
| Lot number | Does it match the purchased vial? |
| Test date | When was the material analyzed? |
| HPLC result | What purity was reported? |
| Chromatogram | Is the analytical profile provided? |
| LC-MS result | Does the mass result support identity? |
| Testing laboratory | Who performed the analysis? |
| Method | Which analytical procedures were used? |
| Sample identification | Can the tested sample be tied to the lot? |
IDUN states that its TB-500 product includes a COA per lot and that LC-MS identity is confirmed lot-by-lot.
That's an important distinction from a generic company-wide statement that products are tested.
For research records, save the COA alongside the purchase information and lot number.
If you're checking the current product, start with the IDUN Peptides LOOT30 offer.
What Is the Molecular Weight of IDUN TB-500?IDUN lists the average molecular weight of its full-length TB-500 / Thymosin Beta-4 as approximately 4,963 Da, with a listed monoisotopic mass of 4,960.4863 Da.
The molecular formula given by IDUN is C₂₁₂H₃₅₀N₅₆O₇₈S.
These details are useful when reviewing mass-spectrometry documentation because they establish an expected molecular identity against which an analytical result can be considered.
The product also corresponds to UniProt P62328, another useful database identifier for researchers working with the full-length protein.
When evaluating a TB-500 COA, therefore, the molecular weight should be considered together with the sequence and the reported LC-MS result rather than as an isolated number.
You can check the current product information through the IDUN Peptides offer and apply LOOT30 to see the available savings.
What Is Thymosin Beta-4 Research About?Thymosin Beta-4 is a naturally occurring member of the beta-thymosin family and has been studied extensively in molecular and cellular research.
One established research area concerns actin binding. Published biochemical work has described Thymosin Beta-4 as an intracellular G-actin-sequestering peptide, while later research has examined its relationships with cytoskeletal dynamics, cell migration and other cellular processes.
IDUN's product documentation summarizes this literature and specifically describes the full-length 43-residue peptide as the form corresponding to UniProt P62328.
The existence of this research literature should not be confused with a claim that an IDUN product has a particular clinical effect.
For an SEO article aimed at research procurement, the useful distinction is:
Published research about a molecule ≠ proof that a particular commercial batch produces a clinical outcome.
The relevant supplier question is whether the material's identity and analytical documentation are sufficiently clear for the intended laboratory application.
If you're evaluating the material itself, the IDUN Peptides LOOT30 offer is the appropriate place to check the current listing.
How Much Does IDUN Peptides TB-500 Cost?The current IDUN TB-500 listing starts at $44.99 for the listed product, with a 10 mg size available.
The starting price should not automatically be treated as the final cost because the total depends on the quantity selected, shipping and any applicable promotion.
A useful comparison formula is:
Product price + quantity + shipping − applicable discount = final procurement cost
For example, on a hypothetical $100 eligible order, a full 30% discount would equal $30, leaving a $70 subtotal before other charges. That's simply an illustration of the discount arithmetic; it does not mean every order receives exactly 30%.
Because LOOT30 has been tested and verified as working, the practical way to determine the real saving is to enter the code during checkout and inspect the updated total.
Start with the IDUN Peptides LOOT30 offer.
How to Compare TB-500 SuppliersA useful TB-500 supplier comparison should begin with molecular identity, not price.
| Comparison factor | What to check |
|---|---|
| Exact identity | Full-length Tβ4 or another form? |
| Sequence | Is the sequence published? |
| Amino-acid count | 43 residues for full-length Tβ4 |
| Molecular weight | Does it match the claimed form? |
| Purity | What analytical result is reported? |
| HPLC | Is chromatographic documentation available? |
| LC-MS | Is molecular identity confirmed? |
| COA | Is it lot-specific? |
| Lot traceability | Can the COA be tied to the vial? |
| Quantity | What amount is actually supplied? |
| Price | What is the current price? |
| Shipping | What are the current fulfillment terms? |
| Promotion | What verified discount is available? |
| Final cost | What does checkout actually charge? |
This approach prevents a common problem: comparing two products that use the same market name but represent different molecular forms.
For TB-500 in particular, sequence and molecular identity deserve priority because the market terminology can be inconsistent.
If IDUN's full-length 43-amino-acid specification matches your research requirement, you can check the current IDUN Peptides offer and enter LOOT30 for up to 30% off.
TB-500 and the IDUN Wolverine BlendIDUN also lists a BPC-157 & TB-500 Wolverine Blend in its catalog. The current catalog lists the blend from $59.99.
That gives researchers another procurement distinction to consider: a standalone TB-500 product versus a multi-compound formulation.
They should not be treated as identical products.
The standalone TB-500 listing identifies the material as full-length Thymosin Beta-4. The Wolverine Blend is a separate product containing BPC-157 and TB-500.
If your laboratory specification calls for the standalone compound, the single-compound product is the more direct comparison.
The broader IDUN catalog currently includes BPC-157, CJC-1295 No DAC, DSIP, Epitalon, GHK-Cu, GLP-2 TZ, GLP-3 RT, Ipamorelin, KPV and other research materials.
If TB-500 is specifically what you need, check the IDUN Peptides LOOT30 offer rather than choosing a blend simply because its headline price is different.
What Should Researchers Record When Purchasing TB-500?A straightforward procurement record can include:
| Record | What to capture |
|---|---|
| Supplier | IDUN Peptides |
| Product | TB-500 / full-length Thymosin Beta-4 |
| Sequence | 43-residue mature-chain sequence |
| Quantity | Selected product size |
| Lot number | From vial and COA |
| Purity | COA-reported HPLC result |
| Identity | LC-MS result |
| COA | Save the batch document |
| Product price | Actual listed amount |
| Promo code | LOOT30 |
| Discount | Actual checkout saving |
| Final total | Final order amount |
| Order date | Date purchased |
This creates a useful link between the material received and the documentation supplied for that batch.
It also makes future supplier comparisons easier because you have the same fields recorded for every purchase.
For the current IDUN listing, use the official offer link, apply LOOT30, and retain the resulting documentation with your research records.
Why the 43-Amino-Acid Identity MattersSearchers often type "TB-500 43 amino acid" because they are trying to distinguish full-length Thymosin Beta-4 from the shorter fragment associated with the same market name.
IDUN makes that distinction explicit.
Its product is described as the full-length 43-amino-acid peptide, corresponding to UniProt P62328, with the sequence:
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
The company says LC-MS confirms the full-length identity on a lot-by-lot basis.
That is useful because the sequence is an objective characteristic of the molecular material.
If you're comparing TB-500 suppliers, a product page that clearly states the molecular form gives you a better starting point than one that simply uses the label "TB-500."
You can review IDUN's current full-length product through the LOOT30 offer.
Is IDUN Peptides TB-500 for Human Use?No.
IDUN explicitly states that its TB-500 product is intended for in-vitro laboratory research only, not for human or veterinary use.
This distinction should remain clear even when discussing published research about Thymosin Beta-4.
A research supplier's analytical documentation does not make a product an approved medicine, and a scientific study does not automatically establish that a commercially supplied research material is safe or effective for human use.
For legitimate laboratory procurement, the relevant questions are instead:
- Is the molecular identity clearly defined?
- Does the lot have analytical documentation?
- Does the COA correspond to the material?
- Does the product meet the laboratory specification?
- Are the applicable laws and institutional requirements satisfied?
- Is the final cost acceptable?
If those criteria fit your research project, the IDUN Peptides LOOT30 offer is where you can check the current listing and apply LOOT30.
IDUN TB-500: One Important CaveatThe strongest feature of the current listing is also the reason researchers should read it carefully: TB-500 terminology is not completely consistent across the market.
IDUN is unusually explicit that its product is full-length Thymosin Beta-4 rather than the shorter fragment sometimes marketed under the same name.
That is a positive for transparency, but it means researchers should not compare products based on the name alone.
Before purchasing, verify:
- Molecular form
- Sequence
- Molecular weight
- Analytical identity
- Lot-specific COA
- Quantity
- Final price
Then apply the discount.
For the current IDUN product, LOOT30 provides up to 30% off, so use the IDUN Peptides offer and confirm the actual checkout saving.
Frequently Asked Questions About IDUN Peptides TB-500 and LOOT30| Question | Answer |
|---|---|
| What is the IDUN Peptides TB-500 promo code for 2026? | The verified code is LOOT30, which provides up to 30% off eligible orders. |
| Does LOOT30 work on IDUN TB-500? | The code has been tested and verified as working. Apply it at checkout and confirm the displayed saving. |
| How much discount does LOOT30 give on TB-500? | The promotion provides up to 30% off. The exact amount should be confirmed in the checkout total. |
| What is the current IDUN TB-500 price? | The current product listing starts at $44.99. |
| What size TB-500 does IDUN list? | The current product page lists a 10 mg size. |
| Is IDUN TB-500 full-length Thymosin Beta-4? | Yes. IDUN identifies its product as the full-length 43-amino-acid Thymosin Beta-4. |
| How many amino acids are in IDUN TB-500? | IDUN's product is the 43-amino-acid full-length form. |
| What is the sequence of IDUN TB-500? | The listed mature-chain sequence is SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES. |
| What purity does IDUN report for TB-500? | IDUN reports ≥99% HPLC purity. |
| Does IDUN TB-500 have a COA? | Yes. IDUN states that a Certificate of Analysis is supplied per lot. |
| Does IDUN TB-500 have LC-MS testing? | Yes. IDUN says the full-length identity is confirmed lot-by-lot using LC-MS. |
| What is the molecular weight of IDUN TB-500? | IDUN lists an average molecular weight of approximately 4,963 Da. |
| What is the UniProt identifier for full-length Thymosin Beta-4? | IDUN identifies the product with UniProt P62328. |
| Is TB-500 always the same molecule across suppliers? | No. The market name can refer to different molecular forms, so researchers should verify sequence and identity rather than relying on the name alone. |
| What is the difference between full-length Tβ4 and the shorter TB-500 fragment? | Full-length Tβ4 contains 43 amino acids, while the shorter fragment commonly associated with the TB-500 name is chemically distinct. IDUN's product is the full-length form. |
| Is IDUN TB-500 intended for human use? | No. IDUN states that the product is for in-vitro research and laboratory use only. |
| How should I evaluate an IDUN TB-500 COA? | Match the product and lot, then review HPLC purity, LC-MS identity, test date, laboratory information and other available analytical details. |
| Is a 99% HPLC purity claim enough by itself? | No. HPLC purity is one analytical attribute. Identity confirmation and lot-specific documentation should also be considered. |
| How do I get the IDUN TB-500 discount? | Visit the IDUN Peptides LOOT30 offer, enter LOOT30, and check the updated order total. |
| How do I verify that LOOT30 applied? | Apply the code during checkout and inspect the updated order summary before completing the purchase. |
| Does IDUN also sell a BPC-157 and TB-500 blend? | Yes. IDUN's current catalog lists a separate BPC-157 & TB-500 Wolverine Blend. |
| Should I compare TB-500 by price alone? | No. Compare molecular form, sequence, quantity, analytical testing, COA documentation, lot traceability and final delivered cost. |
For researchers evaluating TB-500, the most important fact about the current IDUN listing is its molecular identity: IDUN describes the product as full-length 43-amino-acid Thymosin Beta-4, corresponding to UniProt P62328, rather than the shorter fragment that can also be marketed under the TB-500 name.
The current listing reports ≥99% HPLC purity, third-party HPLC + LC-MS testing, lot-specific COA documentation, a 10 mg size and a starting price of $44.99.
That gives researchers several concrete criteria to evaluate before purchasing: exact molecular form, sequence, analytical identity, lot documentation, quantity and price.
The verified LOOT30 promo code provides up to 30% off, so if TB-500 is already the research material you require, there's a practical reason to check the promotion before paying the standard price.
For supporting content in your IDUN content cluster, you can also reference the previously published IDUN Peptides Ipamorelin Research Guide 2026.
If full-length Thymosin Beta-4 is the research material you need, visit the IDUN Peptides LOOT30 offer, enter LOOT30, and verify your final order total for up to 30% off.